GH Axis · Placeholder catalog data
Sermorelin
Also known as GHRH(1-29)-NH2
A 29-amino-acid amidated fragment corresponding to the active N-terminal region of growth hormone-releasing hormone, used in laboratory research on GHRH receptor signaling and pituitary GH-axis models.
130 credits
Paid from your credit pool at checkout. Bulk quantities discount automatically.
Available variants
Pricing and fulfillment information is placeholder data.
| Amount | SKU | Credits | MSRP | Availability | Margin estimate |
|---|---|---|---|---|---|
| 5 mg | PTS-SER-5 | 26 credits | $45 | Ready | 42% estimate |
Margin estimate treats 1 credit as $1 and compares estimated wholesale credit cost with placeholder MSRP. It excludes shipping, taxes, and other costs.
Buy more, save more
Quantity breaks apply per line item and are deducted automatically at checkout.
| Quantity per line | Discount | Example (5 mg unit) |
|---|---|---|
| 10+ units | 5% off | 10 × 26 credits → 247 credits |
| 25+ units | 10% off | 25 × 26 credits → 585 credits |
| 50+ units | 15% off | 50 × 26 credits → 1,105 credits |
| 100+ units | 20% off | 100 × 26 credits → 2,080 credits |
Specifications
- CAS
- 86168-78-7
- Formula
- C149H246N44O42S
- Molecular weight
- 3357.93 g/mol
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Purity
- ≥99%
- Appearance
- White lyophilized powder
- Storage
- Store lyophilized at −20 °C, protected from light and moisture
Quality record
COA status
COA listedLot PTS-SER-2607
Placeholder reference. Verify the active lot before ordering.
Research background
Sermorelin is the amidated 1-29 fragment of human GHRH, retaining the receptor-active N-terminal sequence studied in GH-axis signaling models.
Published research uses Sermorelin and related GHRH analogs to investigate somatotroph receptor activation, pulsatile growth hormone release, and endocrine feedback pathways in controlled research settings.
Supplied exclusively as a research reagent.
Mechanism: Literature describes Sermorelin as a GHRH receptor agonist used to study cAMP-mediated signaling in anterior pituitary somatotroph research models.
Research use only
For research use only. Not for human or veterinary use.