GH Axis · Placeholder catalog data
CJC-1295 (no DAC)
Also known as Modified GRF(1-29)
A tetrasubstituted analog of GHRH(1-29) engineered for metabolic stability. Widely used in preclinical research on pulsatile growth hormone release.
145 credits
Paid from your credit pool at checkout. Bulk quantities discount automatically.
Available variants
Pricing and fulfillment information is placeholder data.
| Amount | SKU | Credits | MSRP | Availability | Margin estimate |
|---|---|---|---|---|---|
| 5 mg | PTS-CJC-5 | 29 credits | $39 | Ready | 26% estimate |
| 10 mg | PTS-CJC-10 | 38 credits | $65 | Ready | 42% estimate |
Margin estimate treats 1 credit as $1 and compares estimated wholesale credit cost with placeholder MSRP. It excludes shipping, taxes, and other costs.
Buy more, save more
Quantity breaks apply per line item and are deducted automatically at checkout.
| Quantity per line | Discount | Example (5 mg unit) |
|---|---|---|
| 10+ units | 5% off | 10 × 29 credits → 276 credits |
| 25+ units | 10% off | 25 × 29 credits → 653 credits |
| 50+ units | 15% off | 50 × 29 credits → 1,233 credits |
| 100+ units | 20% off | 100 × 29 credits → 2,320 credits |
Specifications
- CAS
- 863288-34-0
- Formula
- C152H252N44O42
- Molecular weight
- 3367.97 g/mol
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- Purity
- ≥99%
- Appearance
- White lyophilized powder
- Storage
- Store lyophilized at −20 °C, protected from light and moisture
Quality record
COA status
COA listedLot PTS-CJC-2607
Placeholder reference. Verify the active lot before ordering.
Research background
CJC-1295 without DAC, also referred to as Modified GRF(1-29), is a synthetic analog of the first 29 amino acids of endogenous GHRH, with substitutions (D-Ala², Gln⁸, Ala¹⁵, Leu²⁷) that confer resistance to proteolytic cleavage.
Published preclinical and early clinical literature has investigated the peptide's action at the pituitary GHRH receptor and its influence on pulsatile GH release in animal models and healthy human volunteers.
The peptide is commonly used in laboratory settings to interrogate GH axis physiology, often paired with a GH secretagogue such as Ipamorelin in dual-stimulation research protocols.
Mechanism: Literature describes CJC-1295 as a GHRH receptor agonist acting on somatotroph cells of the anterior pituitary to stimulate pulsatile growth hormone release.
Research use only
For research use only. Not for human or veterinary use.